PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G208300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 280aa    MW: 30906.8 Da    PI: 5.0585
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G208300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding482.9e-151461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++lv      G  +W+++++  g+ R++k+c++rw +yl
  Sevir.2G208300.2.p 14 KGPWTAEEDQKLVSFLLNNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

2Myb_DNA-binding56.37.6e-1870111447
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          ++eE++  +d++++lG++ W++Ia++++ gRt++++k++w+++
  Sevir.2G208300.2.p  70 LSPEEEKTVIDLHAELGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                         69*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.5E-20562IPR009057Homeodomain-like
PROSITE profilePS5129413.917961IPR017930Myb domain
SuperFamilySSF466893.71E-2711108IPR009057Homeodomain-like
SMARTSM007172.6E-111363IPR001005SANT/Myb domain
PfamPF002496.0E-141461IPR001005SANT/Myb domain
CDDcd001673.66E-81661No hitNo description
PROSITE profilePS5129427.56962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2663117IPR009057Homeodomain-like
SMARTSM007173.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.6E-1670111IPR001005SANT/Myb domain
CDDcd001678.31E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVSFLL NNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SPEEEKTVID LHAELGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLQ PAPPPQEPTG SPEEEKIVTA VTPGHEAFCT DDVPLAHLLD DIVFPAGEEV  180
GAQPAPSDGI TMAYSPDQSS SSSSSSSYSA SVAAASSGGN SSADGEWPDW PPMDWPESMW  240
QLEDVVTGRT PWEFEDPFVT YQRIALFDHQ ETCCNVELF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0837351e-146BT083735.2 Zea mays full-length cDNA clone ZM_BFb0033K01 mRNA, complete cds.
GenBankBT0855211e-146BT085521.2 Zea mays full-length cDNA clone ZM_BFc0028P12 mRNA, complete cds.
GenBankBT0856251e-146BT085625.2 Zea mays full-length cDNA clone ZM_BFc0040A03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956766.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-83ODO1_PETHY; Protein ODORANT1
TrEMBLK3ZZA70.0K3ZZA7_SETIT; Uncharacterized protein
STRINGSi031939m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.12e-84myb domain protein 20